Protein Info for B158DRAFT_0401 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF04361: DUF494" amino acids 5 to 154 (150 residues), 139.5 bits, see alignment E=4.3e-45

Best Hits

Swiss-Prot: 38% identical to SMG_NITOC: Protein Smg homolog (smg) from Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)

KEGG orthology group: K03747, Smg protein (inferred from 96% identity to kko:Kkor_2615)

Predicted SEED Role

"Protein of unknown function Smg" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>B158DRAFT_0401 Uncharacterized protein conserved in bacteria (Kangiella aquimarina DSM 16071)
MKEDVLDVLLYIFENFQDEESNHILANDSLIEALEDVGFTDGEIKGAIDWLDGLVEITSE
SSKSEDLATDSMRVFSPQEQLLMSADAQGMILYFEQRGILDPQAREMVIDRMLALGPQED
VETELDRLRWVVMMVLFNLQDRDAEFAWVENLESRSEPH