Protein Info for B158DRAFT_0396 in Kangiella aquimarina DSM 16071

Annotation: ribosomal RNA small subunit methyltransferase RsmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01029: NusB
  • amino acids 14 to 134 (121 residues), 74 bits, E=5.4e-24
• TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase
  • amino acids 45 to 440 (396 residues), 410.3 bits, E=5.8e-127
• PF17125: Methyltr_RsmF_N
  • amino acids 153 to 244 (92 residues), 30.6 bits, E=1.4e-10
• PF01189: Methyltr_RsmB-F
  • amino acids 248 to 438 (191 residues), 213.5 bits, E=8.6e-67
• PF01728: FtsJ
  • amino acids 251 to 381 (131 residues), 26.6 bits, E=1.8e-09
• PF13847: Methyltransf_31
  • amino acids 254 to 388 (135 residues), 30.6 bits, E=9.5e-11
• PF13649: Methyltransf_25
  • amino acids 258 to 327 (70 residues), 30.8 bits, E=1.4e-10

Best Hits

Swiss-Prot: 48% identical to RSMB_HAEIN: Ribosomal RNA small subunit methyltransferase B (rsmB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 83% identity to kko:Kkor_2620)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase B (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (443 amino acids)

>B158DRAFT_0396 ribosomal RNA small subunit methyltransferase RsmB (Kangiella aquimarina DSM 16071)
MSVAPNPQVYTGQQLRKQACLALHAIAFEGRSANDVLSSISFEQGSDNGFFRALVLGSCR
YFIRLEAIASQLLQKPFKPKDRDLLCLIIIGLYQLEFSRVPDHAAISETVSVCQQLKKNW
ATNVVNGVLRNFIRQEADLLAKVDSNWDTKFALPDWLISMLKPYYKGQMESLMSAINEQA
PMTLRVNRQKIGRDRYLEQLLEQGLSATAHPIAANGLVLEHPVNVEQLPHFADGYVSVQD
AAAQLAAAILSPTPNSTVLDACAAPGGKTCHLLELFDSIELTACDIDHDRCQRISENLLR
LQLRAKVDCQDLTDSNFTDGQFDAILLDAPCSATGVIRRHPDIKLLRKANDIDQLVHLQQ
QILEHLWSKLKPGGHLLYATCSILPQENEQQIDRFLESHSDAKLLPLSSEIQQLSHSKTG
CQLIPGQLSMDGFYYALLEKATN