Protein Info for B158DRAFT_0394 in Kangiella aquimarina DSM 16071

Annotation: potassium uptake protein, TrkH family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 334 to 361 (28 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 455 to 480 (26 residues), see Phobius details PF02386: TrkH" amino acids 37 to 476 (440 residues), 323.4 bits, see alignment E=1.2e-100 TIGR00933: potassium uptake protein, TrkH family" amino acids 84 to 465 (382 residues), 384.1 bits, see alignment E=4.2e-119

Best Hits

Swiss-Prot: 61% identical to TRKH_VIBPA: Trk system potassium uptake protein TrkH (trkH) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 95% identity to kko:Kkor_2622)

MetaCyc: 58% identical to K+ transporter TrkH (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-3

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>B158DRAFT_0394 potassium uptake protein, TrkH family (Kangiella aquimarina DSM 16071)
MQYATIIRILGILLMVFSLTMLPPAVVSAIYEDGGGSAFISTFLLSLITGFILFWPKRKA
RAELKIRDGFLIVVLFWTVLSTFGAVPFILAQSLPVSLADAIFESFSGLTTTGATVISGL
DDLPHSILYYRQQLQWLGGMGIIVLAVAILPLLGIGGMQLYRAEMPGPMKDNKLTPRIAG
TAKALWYIYLGITIACALAYWLAGMTAFDAIAHSFSTVAIGGFSTHDASIGFFDSHAIEL
ICAFFMFLAGINFALHFISVRTLTIRPYLKDPEFKGYFGILLVIILSCTAVLLYYQEYDF
DDALVKSIFHSVSIATTAGFASADFAAWPTLLPVLLIFASFIGASAGSTGGGMKVIRVLL
LFKQGMREIKRLVHPNGIFLIKLGKTSVSDRVVQAVWGFFATYVVLFVLLMLILLADGLD
QITAFSAVAACMNNLGPGLGDVAVNYSGLSDLAKYVLSFAMLLGRLEIFTLLVLFTPYFW
RR