Protein Info for B158DRAFT_0392 in Kangiella aquimarina DSM 16071

Annotation: Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 47 to 190 (144 residues), 37.2 bits, see alignment E=4.9e-13 PF01323: DSBA" amino acids 50 to 183 (134 residues), 47 bits, see alignment E=3.9e-16

Best Hits

KEGG orthology group: K03673, thiol:disulfide interchange protein DsbA (inferred from 90% identity to kko:Kkor_2624)

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>B158DRAFT_0392 Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis (Kangiella aquimarina DSM 16071)
MKLKTLFGAALALFALTQVACAEANTASEAKEGKDYSIISGAKGVNKPEVMEFFSYTCPH
CYNVEGFLHKWEPTKPEEVEFKQVPVFLPQVPHLTYGYYTAEVLGVLDKVHPAIFNQWHA
QKKIVKSKEDLIPIFQAAGVSQEEFEKAYTSFAVESKVQHAKKLAREFKVMSFPMFVVNQ
KYKIESYEKLDYMLSKFPIEKAQ