Protein Info for B158DRAFT_0385 in Kangiella aquimarina DSM 16071

Annotation: ATP synthase, F1 delta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01145: ATP synthase F1, delta subunit
  • amino acids 7 to 176 (170 residues), 171.9 bits, E=7.4e-55
• PF00213: OSCP
  • amino acids 7 to 176 (170 residues), 180.8 bits, E=1.3e-57

Best Hits

Swiss-Prot: 46% identical to ATPD_PSEPF: ATP synthase subunit delta (atpH) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 93% identity to kko:Kkor_2631)

MetaCyc: 40% identical to ATP synthase F1 complex subunit delta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (178 amino acids)

>B158DRAFT_0385 ATP synthase, F1 delta subunit (Kangiella aquimarina DSM 16071)
MAELTTIARPYAKAAFEYALGAQTVSEWASMLDFVAQAVSNNDVANIISNPSLSAEQKGE
VILKISEGQITDKVENFIKLLARNHRLEALPAIKTRFDVLKADFDKAVEVEVTSATALSD
DQLQRLTEKLTAKLGRKVNIQTQVDSSMIGGLVIKAGDMVIDGSVRGKLNKLSETLRA