Protein Info for B158DRAFT_0374 in Kangiella aquimarina DSM 16071

Annotation: Glycosyltransferases, probably involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 335 to 364 (30 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details amino acids 400 to 424 (25 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 85 to 312 (228 residues), 130.8 bits, see alignment E=1.8e-41 PF00535: Glycos_transf_2" amino acids 87 to 255 (169 residues), 121.5 bits, see alignment E=9e-39 PF10111: Glyco_tranf_2_2" amino acids 106 to 186 (81 residues), 35.8 bits, see alignment E=1.6e-12 PF13506: Glyco_transf_21" amino acids 157 to 310 (154 residues), 52.9 bits, see alignment E=8.3e-18 PF13632: Glyco_trans_2_3" amino acids 173 to 364 (192 residues), 97.9 bits, see alignment E=1.8e-31

Best Hits

KEGG orthology group: None (inferred from 86% identity to kko:Kkor_2642)

Predicted SEED Role

"Glycosyl transferase, family 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>B158DRAFT_0374 Glycosyltransferases, probably involved in cell wall biogenesis (Kangiella aquimarina DSM 16071)
MIHFFKQQPITLRLILISLYLLSATVLVMAFVSDGPISETLLGLKSFLFILVIPLITKLL
VQIYAAIRYSFQPVNQGYTTMTPYKVSVLLPAWNEEVGIIKTIESVLNSDYHDFELIVIN
DGSTDNTDKLVQNFIADYEQHSNQLVPIKYLSLTNGGKARALNKGLEVAQGNIIITIDAD
CIVDQKAIYKFVQRFDDPSVGAVAGNIIVGNKRKPLEWLQQLEYVCGFFYKRADSYFNAV
HIIGGAAAAYRRDVLTNLKGFDEEIITEDIDLSMSILSHGYKTRYAHDAVVYTEGPTDWK
GLRKQRLRWKYGRILCYLKHKELFLSNNSQHSRYLSWFILPLAVYAEIMLLNVGLFLSLF
YCYVIVSQDFALLASVILVSSMLVTMQIKLDSKSSFHRNLIPFIPVAWLLLYVIEFIELV
ALTMSLQKLYNRESVKWQKWNRIGLQQQAAEQTS