Protein Info for B158DRAFT_0372 in Kangiella aquimarina DSM 16071

Annotation: membrane protein insertase, YidC/Oxa1 family, N-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 337 to 362 (26 residues), see Phobius details amino acids 408 to 430 (23 residues), see Phobius details amino acids 450 to 468 (19 residues), see Phobius details amino acids 488 to 509 (22 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 4 to 341 (338 residues), 298.1 bits, see alignment E=1.3e-92 PF14849: YidC_periplas" amino acids 56 to 333 (278 residues), 254.8 bits, see alignment E=1.6e-79 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 343 to 524 (182 residues), 239.5 bits, see alignment E=3.1e-75 PF02096: 60KD_IMP" amino acids 344 to 524 (181 residues), 214.4 bits, see alignment E=9.6e-68

Best Hits

Swiss-Prot: 46% identical to YIDC_MARMS: Membrane protein insertase YidC (yidC) from Marinomonas sp. (strain MWYL1)

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 89% identity to kko:Kkor_2644)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (535 amino acids)

>B158DRAFT_0372 membrane protein insertase, YidC/Oxa1 family, N-terminal domain (Kangiella aquimarina DSM 16071)
MESMRGFFILGFAICSFLLYQAWQKDYGPQPEQEVNEQFGQSNTVANSKVDTNNLIEVVT
DVFKIKIDRVGGDVVYAELNDYNKELNNEQEKAVLFDYRDRVYQAKSALLGTGAPDNQLP
RATYQTKQSSYSLQDGQDELIIPLTWANDEGVLFTKTFTFNRNDYEIGVQYKVNNQSSND
RTYNFVAELIRDQKPTGLEEKSSFGMSPFLGVAYSPEERKYEKISFEDLEEEPINVTRQG
GWIGYLQHYFISAWIPEQQEKIKVTSTVKSNQDTIIRFIQPTVAVPAQGEKVINATLYVG
PKILKRLEAAAPGLEKSLDLSWVWWIGLPLYKLMQFFYSFVANWGVAIILVTLVVKTLLY
PLSAAQYRSMANMRKLAPKMQQLKERYGEDKQRMQQEMMKMYKEEGANPFGGCLPMLLQF
PIFIALYYVLFEAVELRHAPFFGWIQDLSVADPYFVLPLLMGGSMWLMQKLQPQSPTMDP
MQQKIMSYLPVVFTVFMLFFPAGLVLYWLCNNLISVAQQQYITKKIEKQGNAKAK