Protein Info for B158DRAFT_0345 in Kangiella aquimarina DSM 16071

Annotation: transcriptional regulator, ArsR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 PF01022: HTH_5" amino acids 33 to 78 (46 residues), 43.8 bits, see alignment E=1.8e-15 PF01638: HxlR" amino acids 35 to 91 (57 residues), 24.8 bits, see alignment E=1.6e-09

Best Hits

Swiss-Prot: 62% identical to HLYU_VIBCH: Transcriptional activator HlyU (hlyU) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 93% identity to kko:Kkor_0024)

Predicted SEED Role

"Transcriptional activator HlyU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (111 amino acids)

>B158DRAFT_0345 transcriptional regulator, ArsR family (Kangiella aquimarina DSM 16071)
MNQLVTNSNMAFTDEMQKHSAEAAKLLKNISNEQRLMILCILLEKELSVGELNEMLPQLS
QSALSQHLALLRKSDLVTTRRHSQTIYYSLASTEVARIIHLLHEIYCQETC