Protein Info for B158DRAFT_0334 in Kangiella aquimarina DSM 16071

Annotation: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 5 to 113 (109 residues), 96.5 bits, E=1.1e-31
• PF00486: Trans_reg_C
  • amino acids 143 to 219 (77 residues), 77.6 bits, E=6.2e-26

Best Hits

Swiss-Prot: 54% identical to BAER_ECOL6: Transcriptional regulatory protein BaeR (baeR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07664, two-component system, OmpR family, response regulator BaeR (inferred from 90% identity to kko:Kkor_0078)

Predicted SEED Role

"Response regulator BaeR"

Protein Sequence (220 amino acids)

>B158DRAFT_0334 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain (Kangiella aquimarina DSM 16071)
MSTPILIVEDEVKLAELMRDYLIREGYEVEMLHRGDEVMPWLNKHSARLILLDLMLPGMD
GLSLCRDIRKNSNLPIIMVTARVEEIDRLLGLSSGADDYICKPFSPREVCARVAAVLRRV
EGMATAQDTLEIDEEKYQVRAGGQVLELTALEFRLISTLAKQPGRVFSRDQLMDAIYTDQ
RLVSERTIDSHVKKLRKKLEQLPLADNPIRSIYGVGYKFD