Protein Info for B158DRAFT_0324 in Kangiella aquimarina DSM 16071

Annotation: Cytochrome B561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 10 to 190 (181 residues), 105 bits, see alignment E=2.1e-34

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>B158DRAFT_0324 Cytochrome B561 (Kangiella aquimarina DSM 16071)
MQLKNTSETYGSIAKGFHWITAILYLASYCAIYYQNWLAESDFEKWSSIQLHLSIGITLG
GLIVLRIIWRCLNQTPDPEPGSKTQRLAARAGHYILYLIMIIMPLSGYLSIADYLSKGGV
ITYFLWFDITLFRDVELVSLFGVTLEQLEDPAELVHYYLGAWVIWLLIVGHISAALYHHY
IKKDKTLSKMAFQKQ