Protein Info for B158DRAFT_0302 in Kangiella aquimarina DSM 16071

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details PF02659: Mntp" amino acids 31 to 176 (146 residues), 160 bits, see alignment E=2e-51

Best Hits

Swiss-Prot: 66% identical to MNTP_COLP3: Putative manganese efflux pump MntP (mntP) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: None (inferred from 88% identity to kko:Kkor_0119)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>B158DRAFT_0302 Predicted membrane protein (Kangiella aquimarina DSM 16071)
MLEVIILAIALSMDAFAVSIGLGSKPVASHRKLAIQAAVYFGLFQGLMPLIGYLGGKGLL
GWIEVYAPWIAFLLLLFIGGKMIFEAFSEGIEDDIAQITQRVMLTLAIATSIDAMAAGFA
LNLLDANPFVACLIIGLITMLMSTIGVYIGKRSGTWLESKAELLGGVILILIAIKLVLS