Protein Info for B158DRAFT_0272 in Kangiella aquimarina DSM 16071

Annotation: pyridoxal-dependent decarboxylase, exosortase A system-associated

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03099: pyridoxal-dependent decarboxylase, exosortase A system-associated
  • amino acids 12 to 408 (397 residues), 586.1 bits, E=1.8e-180
• PF00278: Orn_DAP_Arg_deC
  • amino acids 38 to 386 (349 residues), 70.3 bits, E=2e-23
• PF01168: Ala_racemase_N
  • amino acids 42 to 207 (166 residues), 30.3 bits, E=5e-11
• PF02784: Orn_Arg_deC_N
  • amino acids 45 to 290 (246 residues), 163.4 bits, E=9.9e-52

Best Hits

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 86% identity to kko:Kkor_0146)

Predicted SEED Role

No annotation

MetaCyc Pathways

• L-lysine biosynthesis I (9/9 steps found)
• aspartate superpathway (20/25 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (13/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (10/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.20

Use Curated BLAST to search for 4.1.1.20

Protein Sequence (408 amino acids)

>B158DRAFT_0272 pyridoxal-dependent decarboxylase, exosortase A system-associated (Kangiella aquimarina DSM 16071)
MSLKTHADMSQFTTRDSQLVIAGHAIDQLAAIAGQTPFYVYDRAVIQQNVETLRHYFPEV
SLHYAIKANPMPAVVNYLSQQVDGLDVASAKELHIALSTGISPSKVSFAGPGKSTQELSM
AIAAGITLNVESITELERIIAIVEHDNTSANVALRLNPDFELKSSGMKMGGGPQQFGIDV
EQLDSVFELLKHPKLHFMGLHIFTGSQNLNAGSIITAHNSIFALVDRLQQEYSFSLKHLN
IGGGFGIPYFPGDQLLDLEPIADNLNQLITEHQKLLVDCELILELGRYLVGNAGVYVCQI
TDKKISRDQTYLICNGGLHHHLAASGNFGQVIRKNYPVAIANRMQQSDTELVNIVGPLCT
PLDILANKMELPKAEIGDWVAVFQSGAYGFTASPRDFLSHPHPVELLL