Protein Info for B158DRAFT_0272 in Kangiella aquimarina DSM 16071

Annotation: pyridoxal-dependent decarboxylase, exosortase A system-associated

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR03099: pyridoxal-dependent decarboxylase, exosortase A system-associated" amino acids 12 to 408 (397 residues), 586.1 bits, see alignment E=1.8e-180 PF00278: Orn_DAP_Arg_deC" amino acids 38 to 386 (349 residues), 70.3 bits, see alignment E=2e-23 PF01168: Ala_racemase_N" amino acids 42 to 207 (166 residues), 30.3 bits, see alignment E=5e-11 PF02784: Orn_Arg_deC_N" amino acids 45 to 290 (246 residues), 163.4 bits, see alignment E=9.9e-52

Best Hits

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 86% identity to kko:Kkor_0146)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.20

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>B158DRAFT_0272 pyridoxal-dependent decarboxylase, exosortase A system-associated (Kangiella aquimarina DSM 16071)
MSLKTHADMSQFTTRDSQLVIAGHAIDQLAAIAGQTPFYVYDRAVIQQNVETLRHYFPEV
SLHYAIKANPMPAVVNYLSQQVDGLDVASAKELHIALSTGISPSKVSFAGPGKSTQELSM
AIAAGITLNVESITELERIIAIVEHDNTSANVALRLNPDFELKSSGMKMGGGPQQFGIDV
EQLDSVFELLKHPKLHFMGLHIFTGSQNLNAGSIITAHNSIFALVDRLQQEYSFSLKHLN
IGGGFGIPYFPGDQLLDLEPIADNLNQLITEHQKLLVDCELILELGRYLVGNAGVYVCQI
TDKKISRDQTYLICNGGLHHHLAASGNFGQVIRKNYPVAIANRMQQSDTELVNIVGPLCT
PLDILANKMELPKAEIGDWVAVFQSGAYGFTASPRDFLSHPHPVELLL