Protein Info for B158DRAFT_0270 in Kangiella aquimarina DSM 16071

Annotation: VanZ like family.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 234 to 251 (18 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 354 to 371 (18 residues), see Phobius details PF04892: VanZ" amino acids 34 to 123 (90 residues), 47.2 bits, see alignment E=1.8e-16

Best Hits

KEGG orthology group: None (inferred from 88% identity to kko:Kkor_0148)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>B158DRAFT_0270 VanZ like family. (Kangiella aquimarina DSM 16071)
MRLIWYIVILFITYGSLYPFDFGLSRDLPDDFSKWLFSWHHRTIRSDLIANILLFIPYGF
FGALTIKEENRGWPLLWIILTFIGGFLFALFLQILQFYLPSRIPEAADALTNSIGILVGF
ALAGFTNSQRVQRLIPRGLRFQLTPALLVLVLWLAWQFFPYIPVFEGKQFGDGLSHIVSS
GWSLELWMERILFWMVFYYVLERVVAKKYSMTVIIGITLFVLIIKLAMYRSQLGWSEISA
VPLAILLHAYLGHSVKVVLITIGAATLFVWQNLFPWHWQSTINSFEWMPFDNFLTGSTWN
NLSALLRESLLLASFGYFLGKWLSSYRAAGTVLTVFVILVTALQFFIVGKQPDSTSIVMA
LVLAILFHRLAKIAP