Protein Info for B158DRAFT_0266 in Kangiella aquimarina DSM 16071

Annotation: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 60 to 80 (21 residues), see Phobius details TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 93 to 281 (189 residues), 264.7 bits, see alignment E=2.4e-83 PF00117: GATase" amino acids 94 to 283 (190 residues), 212.6 bits, see alignment E=4.3e-67 PF07722: Peptidase_C26" amino acids 146 to 266 (121 residues), 43.3 bits, see alignment E=3.8e-15

Best Hits

KEGG orthology group: None (inferred from 91% identity to kko:Kkor_0152)

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>B158DRAFT_0266 glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase (Kangiella aquimarina DSM 16071)
MRKVWWVLVALVVAAFIGHYIADQAAIDECLKTGGTYFYDQHYCSKTEAYAGSTNYISNH
IGFIILLVLSVAFAIGAYFIKAPKPMVGKHKRLLMIDNYDSFTYNLVQYFADLGLDVLVK
RNDELTVKEAKEINPDYIVISPGPATPNESGISLAVIEELAEDYPILGVCLGHQAMAQVF
GGRIIRAKQVMHGKTSEIHHANKGVFKDLPNPIEATRYHSLVVDNDSLPQEFEVTAWTED
EEGELEYIMGIKHKSLKLEGVQFHPESIMSQHGHQMLKNFILEYRN