Protein Info for B158DRAFT_0264 in Kangiella aquimarina DSM 16071

Annotation: cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF00027: cNMP_binding" amino acids 22 to 111 (90 residues), 85.9 bits, see alignment E=2.3e-28 PF13545: HTH_Crp_2" amino acids 143 to 206 (64 residues), 47.1 bits, see alignment E=2.7e-16 PF00325: Crp" amino acids 167 to 198 (32 residues), 40 bits, see alignment 4e-14

Best Hits

Swiss-Prot: 66% identical to VFR_PSEAE: Cyclic AMP receptor-like protein (vfr) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10914, CRP/FNR family transcriptional regulator, cyclic AMP receptor protein (inferred from 99% identity to kko:Kkor_0153)

Predicted SEED Role

"Cyclic AMP receptor protein" in subsystem CytR regulation or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>B158DRAFT_0264 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases (Kangiella aquimarina DSM 16071)
MALPYHLAQDETIQWFLNHCQRRRFPAKSTLIYAGDSSNTLYFLLEGSVTVLIEDDEGRE
LVLAYLNPGDFFGEMGLFTDDHDRTAWVRTKSECEVAEISYDKFRQLTRENPDVLFRLAT
QLATRLRKTSRKVGDLAFLDVTGRVAHALLELAKEPDAMTHPDGMQIKVTRQELSRIVGC
SREMVGRVLKALEEEGHIHVKGKTMVIFGAR