Protein Info for B158DRAFT_0260 in Kangiella aquimarina DSM 16071

Annotation: Putative protein-S-isoprenylcysteine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 92 to 119 (28 residues), see Phobius details PF04191: PEMT" amino acids 41 to 140 (100 residues), 58.3 bits, see alignment E=9.9e-20 PF04140: ICMT" amino acids 73 to 135 (63 residues), 26.6 bits, see alignment E=6.4e-10

Best Hits

KEGG orthology group: None (inferred from 47% identity to ilo:IL2496)

Predicted SEED Role

"Putative protein-S-isoprenylcysteine methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>B158DRAFT_0260 Putative protein-S-isoprenylcysteine methyltransferase (Kangiella aquimarina DSM 16071)
MHALELKIPPIIVLFLFALLMWVTQYLFSILPYTFVGKDFFAWTLYCLGALCSLLGVYQF
RKVQTTVDPRFPEQTSSLVRSGIYRFSRNPMYLGFLFILIGWAIQLADVLLLLFLPSFIA
YMNRFQIIPEERYLAAKFGSDFNDYQLKVRRWL