Protein Info for B158DRAFT_0258 in Kangiella aquimarina DSM 16071

Annotation: transporter, NhaC family (TC 2.A.35)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 65 to 92 (28 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details amino acids 370 to 394 (25 residues), see Phobius details amino acids 430 to 449 (20 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 166 to 448 (283 residues), 146.7 bits, see alignment E=9.7e-47 PF03606: DcuC" amino acids 196 to 434 (239 residues), 38.4 bits, see alignment E=5.7e-14

Best Hits

KEGG orthology group: None (inferred from 98% identity to kko:Kkor_0161)

Predicted SEED Role

"Na+/H+ antiporter family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>B158DRAFT_0258 transporter, NhaC family (TC 2.A.35) (Kangiella aquimarina DSM 16071)
MSWLSILPPIVAILIAVWKRQVIIALLMAIFTAELVLVGGNPIHAFTDTVDRLVSVFSSA
YNTRILMFSLLIGALIQLIKISGGVSALVNWLTRKEYVHNQRRAGMLPTILGSSIFIDTN
MSVLTAGLSSQALFDKFKMSRARLAYIIDSTCAPISVLILLNGWGAAILGHVEKTGVTNP
TEVLVTSIGLNFYAIVTLLIVFYTVYTGKVYGPMKAEESKALEVPSEPLPPATKKRYMLW
PLAFMVLSILVFMFITGDGDLRKGSGSESVLWSVILSTLLIFALLRFDAKRKTKELMEES
FKGLGHLLPLVTLVLLAFALSDSMTDLKTGEFVAGAVGDFLPLWIIPALIFVLAGFISFT
TGTSWGTFGILIPIAIPLAVSLGISPSLVLAAVLGGSVFGDHASPISDTTVISSLAAGCD
LLDHVKTQLPYALFAGGISIVLYIIFGLIG