Protein Info for B158DRAFT_0244 in Kangiella aquimarina DSM 16071

Annotation: tyrosine recombinase XerC subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF02899: Phage_int_SAM_1" amino acids 5 to 88 (84 residues), 72.5 bits, see alignment E=2.8e-24 TIGR02224: tyrosine recombinase XerC" amino acids 7 to 296 (290 residues), 353 bits, see alignment E=7.1e-110 PF00589: Phage_integrase" amino acids 112 to 282 (171 residues), 171.5 bits, see alignment E=1.5e-54

Best Hits

Swiss-Prot: 49% identical to XERC_MANSM: Tyrosine recombinase XerC (xerC) from Mannheimia succiniciproducens (strain MBEL55E)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 88% identity to kko:Kkor_0177)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>B158DRAFT_0244 tyrosine recombinase XerC subunit (Kangiella aquimarina DSM 16071)
MESDIQRYLNRLLHEKRYSEHTVNNYRRQLEKLLAFCQNAGYNNWQQITTQDIRMLIAKQ
HRQGASPATCALLLSASRRFLEFLLSEKKIKLNSAVGVRGPKKAKRLPKNIDVDSLNHFL
DQMPEDESLQIRDKAMMELLYSSGIRLAELSGMDVNDLSFSDQILRVLGKGNKIREVPFG
NSAKKILTIWIKERNQLVKSADEKALFVSQQGNRLTNRAIQQRLSHWGKQLGLNDRLHPH
KLRHSCATHVLESSSDLRAVQELLGHASISTTQIYTHLDFQHLAKTYDAAHPRARKKKD