Protein Info for B158DRAFT_0224 in Kangiella aquimarina DSM 16071

Annotation: Regulator of competence-specific genes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF04993: TfoX_N" amino acids 13 to 93 (81 residues), 40.7 bits, see alignment E=1.1e-14

Best Hits

Swiss-Prot: 43% identical to YTR3_SPIAU: Uncharacterized 12.7 kDa protein in trpE 5'region from Spirochaeta aurantia

KEGG orthology group: None (inferred from 93% identity to kko:Kkor_0194)

Predicted SEED Role

"FIG00764021: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>B158DRAFT_0224 Regulator of competence-specific genes (Kangiella aquimarina DSM 16071)
MASDLEFVEFVVEQIADECDITYRKMFGEYAVYSKGKVVALICDNQLFIKPTAVGKEFIG
DYVEAPAYPGAKPSLLIEDQIEESEWLTQLIRVTERELPTPKPKKKKTAKKSGK