Protein Info for B158DRAFT_0198 in Kangiella aquimarina DSM 16071

Annotation: Predicted integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 94 to 145 (52 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details PF02325: YGGT" amino acids 10 to 73 (64 residues), 50.6 bits, see alignment E=1e-17 amino acids 117 to 184 (68 residues), 51.8 bits, see alignment E=4.4e-18

Best Hits

KEGG orthology group: K02221, YggT family protein (inferred from 85% identity to kko:Kkor_0215)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>B158DRAFT_0198 Predicted integral membrane protein (Kangiella aquimarina DSM 16071)
MNPVFTIIEYVINLFAMVFLLRVLLQLGSADFFNPIAQFIHKFTAPVINPLRSVLPDIGK
FNLAAFVFALALLTGKIFAFKYYFLSQADASMLTTPVMLFLVLVGLGPISGLFMVISNLL
LILFIGLMIASFVSGGRYNPGLIFLVQVTRPILRPIQKIIPPLGGTIDLSPMIVLLGLFF
LQSALYNFGVSLLSQ