Protein Info for B158DRAFT_0177 in Kangiella aquimarina DSM 16071

Annotation: methionine adenosyltransferase (EC 2.5.1.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01034: methionine adenosyltransferase
  • amino acids 6 to 383 (378 residues), 640.2 bits, E=5.1e-197
• PF00438: S-AdoMet_synt_N
  • amino acids 6 to 102 (97 residues), 149.4 bits, E=5.5e-48
• PF02772: S-AdoMet_synt_M
  • amino acids 116 to 232 (117 residues), 163.9 bits, E=2.5e-52
• PF02773: S-AdoMet_synt_C
  • amino acids 234 to 373 (140 residues), 232.3 bits, E=2.4e-73

Best Hits

Swiss-Prot: 81% identical to METK_SHESW: S-adenosylmethionine synthase (metK) from Shewanella sp. (strain W3-18-1)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 96% identity to kko:Kkor_0237)

MetaCyc: 80% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (20/25 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage II (2/3 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• S-adenosyl-L-methionine salvage I (1/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
• L-methionine salvage cycle III (4/11 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)
• L-methionine salvage cycle I (bacteria and plants) (3/12 steps found)
• L-methionine salvage cycle II (plants) (1/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Protein Sequence (386 amino acids)

>B158DRAFT_0177 methionine adenosyltransferase (EC 2.5.1.6) (Kangiella aquimarina DSM 16071)
MSNYSVFTSESVSEGHPDKIADQISDAVLDAILAQDINARVAVETMVKTGMVIVAGEVAT
SAWVDIEELARNTIKQIGYNSSEMGFDWESCAVLNAIGKQSPDIAQGVDRDDPEAQGAGD
QGLMFGYASNETDVLMPAPITYSHRLVQKQAELRKNGKLAWLRPDAKSQLTFRYENDKPV
GIDAVVLSTQHDPEISQKDLQEAVIEEIIKPVLPAEWISDKTKYFVNPTGKFVIGGPMGD
CGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLADRCEIQV
SYAIGVAEPTSISVNTFGTGKVSEDKLVELVREHFDLRPRGLTKMLNLLQPIYQATAAYG
HFGRTEDSFTWERTDKAEALRAAAGL