Protein Info for B158DRAFT_0159 in Kangiella aquimarina DSM 16071

Annotation: acetyl-CoA carboxylase, biotin carboxylase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00289: Biotin_carb_N
  • amino acids 1 to 110 (110 residues), 150.5 bits, E=7.3e-48
• TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit
  • amino acids 1 to 443 (443 residues), 787.2 bits, E=2.4e-241
• PF02655: ATP-grasp_3
  • amino acids 114 to 294 (181 residues), 30.3 bits, E=1.3e-10
• PF02786: CPSase_L_D2
  • amino acids 115 to 322 (208 residues), 282.8 bits, E=4.7e-88
• PF02222: ATP-grasp
  • amino acids 144 to 293 (150 residues), 35.7 bits, E=2e-12
• PF07478: Dala_Dala_lig_C
  • amino acids 145 to 291 (147 residues), 38 bits, E=3.8e-13
• PF02785: Biotin_carb_C
  • amino acids 336 to 442 (107 residues), 135.8 bits, E=1.9e-43

Best Hits

Swiss-Prot: 78% identical to ACCC_HAEIN: Biotin carboxylase (accC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01961, acetyl-CoA carboxylase, biotin carboxylase subunit [EC: 6.3.4.14 6.4.1.2] (inferred from 98% identity to kko:Kkor_0254)

MetaCyc: 77% identical to biotin carboxylase (Escherichia coli K-12 substr. MG1655)
Biotin carboxylase. [EC: 6.3.4.14]

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• 3-hydroxypropanoate cycle (6/13 steps found)
• glyoxylate assimilation (6/13 steps found)
• jadomycin biosynthesis (3/9 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• superpathway of mycolate biosynthesis (17/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 6.3.4.14 or 6.4.1.2

Protein Sequence (449 amino acids)

>B158DRAFT_0159 acetyl-CoA carboxylase, biotin carboxylase subunit (Kangiella aquimarina DSM 16071)
MLEKVVIANRGEIALRILRACRELGIKTVAVHSTADEDLMHVRLADESVCIGPASAQASY
LNIPAIISAAEITDAVGIHPGYGFLAENADFAEQVEQSGFTFIGPRADTIRLMGDKVSAI
SAMKKAGVPCVPGSDGPLGNNEKDNIAMAKRIGYPVIIKAAGGGGGRGMRVVRKESELVK
AIELTKAEAGSAFNNDMVYMEKFLENPRHIEIQVLADSHGNAIYLGERDCSMQRRHQKVV
EEAPAPGISEQMRRHIGERCVQACKEIGYRGAGTFEFLYEKGEFYFIEMNTRVQVEHPVT
ELITGVDIIKEQLRIASNQPLSFKQEDIKLNGHSIECRINAEDPDTFIPSPGVIQRYHAP
GGPGIRIDSHIYATYKVPPYYDSMIGKLITHGETREVAIARMQMALEEIVIDGIKTNIPL
QKRILADANFHKGGTNIHYLEQHMFGEKE