Protein Info for B158DRAFT_0149 in Kangiella aquimarina DSM 16071

Annotation: Thiol-disulfide isomerase and thioredoxins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF08534: Redoxin" amino acids 36 to 155 (120 residues), 81.7 bits, see alignment E=1.3e-26 PF00578: AhpC-TSA" amino acids 37 to 136 (100 residues), 67 bits, see alignment E=3.8e-22 PF13098: Thioredoxin_2" amino acids 45 to 145 (101 residues), 34.9 bits, see alignment E=4.1e-12 PF13905: Thioredoxin_8" amino acids 46 to 134 (89 residues), 57.8 bits, see alignment E=2.9e-19

Best Hits

KEGG orthology group: None (inferred from 83% identity to kko:Kkor_0264)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>B158DRAFT_0149 Thiol-disulfide isomerase and thioredoxins (Kangiella aquimarina DSM 16071)
MRTPFKQLYSSLLLLAVSSLGSSIATAGDAEHKNLLDQLNLEQYQGKVVYVDFWASWCGP
CRQSFPVMNDLQQTYGEDNFVIIAINEDSEPGAAEQFLAQYPANFTIFYDQNGELAKYFK
VDAMPTSYLLDQTGAAKYRHRGFRQKDVSKLEQQIESLLSEQSVNAGASSASNSGDSE