Protein Info for B158DRAFT_0142 in Kangiella aquimarina DSM 16071

Annotation: ABC-type phosphate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF12849: PBP_like_2" amino acids 99 to 311 (213 residues), 112.7 bits, see alignment E=4.2e-36 PF12727: PBP_like" amino acids 100 to 255 (156 residues), 33.1 bits, see alignment E=4.9e-12 PF00691: OmpA" amino acids 359 to 451 (93 residues), 37.8 bits, see alignment E=3e-13

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 84% identity to kko:Kkor_0273)

Predicted SEED Role

"ompA family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>B158DRAFT_0142 ABC-type phosphate transport system, periplasmic component (Kangiella aquimarina DSM 16071)
MTSLARHFISSLLLGSLFLQSVSAMAEDSSTKTFSADDINKATILFEMKGSNTIGESLAP
GLAEEFLKAEGAIRTGVVETHAVEKTVLGLFPDGTLKAVDIKAHGSSTGFKALAAEDTDI
AMSSRRIKEKEREQMRKLYGDLKSVESELTIAVDGLAVIVHPQLAINTLDTETLARIFAG
DIRNWQEIGGPDQKISLFARDDNSGTFDTFKSLVLSRHNVKLSEYAKRYESSGELSNMVF
NTPGAIGFIGLSYVNQTKPLALSESGVALSFKPNLFTVSTEDYVLSRRLYMYYPANNENP
HARRFMQFVQQDQAQTVVEETGLISLKVNDATIRFNRNYPPRYLNMITDSKRLSITFHFD
EGTDQLDNKAKLDIQRLVNYVNEHQLEDLFLFGFSYESGNEENDKDDSKRLARIIANELE
IAGVKPFYVQGYGSKGAIASNSTENGRNKNRRVEVWVGR