Protein Info for B158DRAFT_0140 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized protein containing a von Willebrand factor type A (vWA) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF12450: vWF_A" amino acids 99 to 191 (93 residues), 129.2 bits, see alignment E=1.2e-41 PF00092: VWA" amino acids 209 to 369 (161 residues), 60.4 bits, see alignment E=6.9e-20 PF13768: VWA_3" amino acids 209 to 366 (158 residues), 40.6 bits, see alignment E=6.9e-14 PF13519: VWA_2" amino acids 210 to 314 (105 residues), 52.1 bits, see alignment E=2.3e-17 PF12034: YfbK_C" amino acids 385 to 565 (181 residues), 245.3 bits, see alignment E=1.2e-76

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 87% identity to kko:Kkor_0275)

Predicted SEED Role

"von Willebrand factor, type A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (581 amino acids)

>B158DRAFT_0140 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain (Kangiella aquimarina DSM 16071)
MNTNKAKTVSKSLKISALATMVAMAIAGCQNTDTAKLQAERDKQVAAAKAEELKRARQEQ
EMIVVTGSRINAQAKERVALHDAAMPAPQSPAMWQQPEVNREQYQHFDESGIFLAKEQPV
STFSIDVDTGSYSNVRRMLNDGYLPPHDAVRLEEFVNYFNYDYQGPESTNQPFAVNTEVF
SAPWNSNAYLMQIGIKGFEPEQEELPPSNLVYLIDVSGSMNSEDKLGLVKKSLKLLAQES
SEQDRISIVVYAGASGVVLEPTRGNDRMAIEQALERLSAGGSTNGGAGIELAYKLAEQAY
IKDGINRVILATDGDFNVGTVNREQLIDLVERKRESGISFTTLGFGSGNYNEHLMEQLAD
KGNGNYGYIDTLQEARKLLVEQRAGTLMTIAKDVKIQVEFNPQVVAEYRLLGYENRALNR
EDFNNDKVDAGEIGAGHTVTALYEVVLVGSEGRRVDELRYAEQQADKQKLADEAALVKLR
YKMPDEDKSQLISHIIERQQFDAEKNVADDSQFAASVAGFAQLLRGGRYLNGWDWQQAIE
LAQNSKGADKDGYRGEMIQLMKMAKLLDEQNTGSQAQVGTE