Protein Info for B158DRAFT_0136 in Kangiella aquimarina DSM 16071

Annotation: cytochrome c oxidase, subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 149 to 175 (27 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details amino acids 412 to 433 (22 residues), see Phobius details amino acids 454 to 476 (23 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 12 to 518 (507 residues), 705.3 bits, see alignment E=2.1e-216 PF00115: COX1" amino acids 20 to 462 (443 residues), 553.4 bits, see alignment E=1.9e-170

Best Hits

Swiss-Prot: 56% identical to COX1_RICBR: Probable cytochrome c oxidase subunit 1 (ctaD) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 98% identity to kko:Kkor_0279)

MetaCyc: 78% identical to cytochrome c oxidase subunit 1 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>B158DRAFT_0136 cytochrome c oxidase, subunit I (Kangiella aquimarina DSM 16071)
MADHKPKGISRWLFTTNHKDIGTMYLVFSFIMFLIGGAMAMVIRAELFQPGLQFVEPNFF
NQMTTLHGLIMVFGAVMPATVGLANWLIPMMIGAPDMALPRMNNWSFWILPAAFILLLSS
LFMEGGAPNFGWTFYAPLSTTYGPPSTDFFIFGVHLMGISSIMGAINVIVTVFNMRAPGM
TLMKMPLFVWTWLITAFLLVMVMPVLAGAVTMMLTDRHFGTSFFDAAGGGDPVMFQHIFW
FFGHPEVYIMILPAFGIASAIIPTFSRKKLFGYSSMVYATASIAFLSFIVWAHHMFTVGM
PVKGELFFMVATMLIAVPTGVKVFNWIATMWQGSITYETPMLYAIAFVILFTIGGFSGVM
LALTPVDWQYHDTYFVVAHFHYVLFPGAIFGTMAAVYYWMPKWTGRMYDEKLAKVHFWLS
IVFVNLTFFPMHFSGLAGMQRRVPDYNIMFSDFNMWSSIGAFGLGLTQFLFLWILIKTCW
LKKGEKATDQVWEGAEGLEFTHLPSPAPYHSFDTPPKVD