Protein Info for B158DRAFT_0134 in Kangiella aquimarina DSM 16071

Annotation: Heme/copper-type cytochrome/quinol oxidase, subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 226 to 250 (25 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details PF00510: COX3" amino acids 12 to 289 (278 residues), 169.2 bits, see alignment E=8.1e-54

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 95% identity to kko:Kkor_0281)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>B158DRAFT_0134 Heme/copper-type cytochrome/quinol oxidase, subunit 3 (Kangiella aquimarina DSM 16071)
MSEQTNTEYEKYYVPEQSKLPFIGSVGLFLTAFGAGHMVQGGSLSWVLWIGLAVLVYMLS
TWWAATIRESMSGLYSAQMSRSFRQGMMWFITSEVMFFAAFFGALFYVRILVMEWLGGSS
NNAATHEFLWPEFIPNWPMEKTPGGETTTGMGAWGLPAINTAILLFSSFTLTIAHHALIE
KNRATLIQFTAITAALGVIFMGLQIWEYIHAYTEMGLTLGSGIYGSTFFMLTGFHGLHVT
VGTIFLIILTIRCAKGHFTPQDHFAYEAGAWYWHFVDVVWVFLFIFVYIL