Protein Info for B158DRAFT_0133 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized iron-regulated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13640: 2OG-FeII_Oxy_3
  • amino acids 91 to 178 (88 residues), 56 bits, E=6.2e-19
• PF18331: PKHD_C
  • amino acids 187 to 227 (41 residues), 26.9 bits, 4.1e-10

Best Hits

Swiss-Prot: 55% identical to Y759_IDILO: PKHD-type hydroxylase IL0759 (IL0759) from Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 78% identity to kko:Kkor_0282)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

• Benzoxazinone biosynthesis
• Diterpenoid biosynthesis
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.11.-

Protein Sequence (227 amino acids)

>B158DRAFT_0133 Uncharacterized iron-regulated protein (Kangiella aquimarina DSM 16071)
MQLILNNIFMILQLSHFIEPATLDVLCEDISKLDFNSGQQTAGHSVRSLKNNEQIILDND
KPAALAMLLKQLQNNSLFQAACLPRQFARVMLNRYQQGMQYGNHVDDAFIAGVRTDVSFT
LCLTPQNDYEGGELVLCDSSGERSWKLDKGEALVYPSTYLHRVNPVTGGTRTAMVGWLQS
KVRFPHQREILFDLKQSSTHEFNTQGKSEQYDRLSKSYSNLLRQWAD