Protein Info for B158DRAFT_0131 in Kangiella aquimarina DSM 16071

Annotation: Predicted hydrolase of the alpha/beta-hydrolase fold

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00561: Abhydrolase_1" amino acids 78 to 317 (240 residues), 63.2 bits, see alignment E=6.3e-21 PF12146: Hydrolase_4" amino acids 79 to 296 (218 residues), 50.3 bits, see alignment E=4.2e-17 PF12697: Abhydrolase_6" amino acids 80 to 314 (235 residues), 40.9 bits, see alignment E=7.9e-14 PF07859: Abhydrolase_3" amino acids 140 to 193 (54 residues), 28.1 bits, see alignment 3.3e-10

Best Hits

KEGG orthology group: K07019, (no description) (inferred from 81% identity to kko:Kkor_0285)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>B158DRAFT_0131 Predicted hydrolase of the alpha/beta-hydrolase fold (Kangiella aquimarina DSM 16071)
MQAEESHNKINPKDVDYTAPNWARNQHIQSLLATVKLRRGFVQKRAQAMIEASREVIIEC
DDGIKLQSFYAEAAQDAPLVVLIHGWEGSHQSLYLLSCASTLFENGYNVIRLNLRDHGDS
HHLNQELFHSNRLDEVIGAVKKIQDKFQPSKLFLAGFSLGGNFALRVANKSKEHGIRLAK
TVAVCPALDPKDILEKLENGLSVYIKYFMYKWKRSLRKKQELFPHLYDIEESLQTDSMRR
LTEELVNYYGDYESINAYFDGYDITGDYLKDLEVETTILLAKDDPIIDYRAIYQLPDKSN
IAYFLSDHGGHCGFIKNYKLHSWLDEFLLEQLSDS