Protein Info for B158DRAFT_0127 in Kangiella aquimarina DSM 16071

Annotation: NADH dehydrogenase subunit A (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details PF00507: Oxidored_q4" amino acids 22 to 117 (96 residues), 135.1 bits, see alignment E=4.2e-44

Best Hits

Swiss-Prot: 62% identical to NUOA_ACISJ: NADH-quinone oxidoreductase subunit A (nuoA) from Acidovorax sp. (strain JS42)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 96% identity to kko:Kkor_0289)

MetaCyc: 36% identical to ferredoxin-quinone oxidoreductase subunit C (Parasynechococcus marenigrum WH 8102)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (118 amino acids)

>B158DRAFT_0127 NADH dehydrogenase subunit A (EC 1.6.5.3) (Kangiella aquimarina DSM 16071)
MIEQYAPILVFIIIGLLFGAGLLLVGYFASPTNPDPAKETAFECGFDAFEDSRMKFDVRF
YLVAILFIIFDLEIAFLFPWAVVFDNLGWFGVISMGVFLLLLLIGFAYEWKKGALEWE