Protein Info for B158DRAFT_0124 in Kangiella aquimarina DSM 16071

Annotation: NADH dehydrogenase subunit D (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 110 to 131 (22 residues), see Phobius details TIGR01962: NADH dehydrogenase (quinone), D subunit" amino acids 6 to 417 (412 residues), 614 bits, see alignment E=4.9e-189 PF00346: Complex1_49kDa" amino acids 120 to 417 (298 residues), 402.4 bits, see alignment E=3.8e-125

Best Hits

Swiss-Prot: 81% identical to NUOD_NITOC: NADH-quinone oxidoreductase subunit D (nuoD) from Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)

KEGG orthology group: K00333, NADH dehydrogenase I subunit D [EC: 1.6.5.3] (inferred from 95% identity to kko:Kkor_0292)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain D (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>B158DRAFT_0124 NADH dehydrogenase subunit D (EC 1.6.5.3) (Kangiella aquimarina DSM 16071)
MAEIRNYTINFGPQHPAAHGVLRLILEMDGETVVRADPHVGLLHRATEKLAESKPYNQSI
GYMDRLDYVSMMCNEHSYVLAIEKLMGIKPPERAQYIRVMFSEITRILNHLMWLGAHALD
IGAMTVFLYAFRERETLMDCYEAVSGARMHATYFRPGGVYRDLPEEMPQYKVSPFTNERK
AEELNANRQGSLLDFIWDFTETFPDRIDEYEALLTENRIWKQRTVGIGVVSPERALQLGF
SGPMLRGSGIAWDLRKKQPYEVYDRMDFDIPIGKTGDCYDRYLVRMEEMRQSNQIIRQCV
QWLRENPGPVMLENHKVTPPDRETMKHDMESLIHHFKLFTEGYCVPEGEAYAAIEHPKGE
FGVYLVSDGANKPYRVKIRAAGFAHLSAMNEMASGHMLADVVAIIGTQDIVFGEIDR