Protein Info for B158DRAFT_0123 in Kangiella aquimarina DSM 16071

Annotation: NADH dehydrogenase subunit E (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01958: NADH-quinone oxidoreductase, E subunit
  • amino acids 17 to 163 (147 residues), 179.7 bits, E=1.9e-57
• PF01257: 2Fe-2S_thioredx
  • amino acids 18 to 163 (146 residues), 174.8 bits, E=4.8e-56

Best Hits

Swiss-Prot: 44% identical to NUOE_RICFE: NADH-quinone oxidoreductase subunit E (nuoE) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K00334, NADH dehydrogenase I subunit E [EC: 1.6.5.3] (inferred from 88% identity to kko:Kkor_0293)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (3/6 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (164 amino acids)

>B158DRAFT_0123 NADH dehydrogenase subunit E (EC 1.6.5.3) (Kangiella aquimarina DSM 16071)
MSANDLTEMVSAESIKQIDRWIAKYPTERKRSAIIPVFTIVQEELGYLSREAMDAVADYL
EIPHIGAYEVATFYSMFRLEPGGKHVVSLCTNVSCMLAGSGNLKQWFKDELGIEPGQTTE
DGRITLKEVECMAACGGAPMLEVDKQYHENLTVETMADLIRDLS