Protein Info for B158DRAFT_0120 in Kangiella aquimarina DSM 16071

Annotation: NADH dehydrogenase subunit H (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details PF00146: NADHdh" amino acids 14 to 328 (315 residues), 417.9 bits, see alignment E=1.3e-129

Best Hits

Swiss-Prot: 71% identical to NUOH2_NITOC: NADH-quinone oxidoreductase subunit H 2 (nuoH2) from Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 93% identity to kko:Kkor_0296)

MetaCyc: 56% identical to MbhM (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>B158DRAFT_0120 NADH dehydrogenase subunit H (EC 1.6.5.3) (Kangiella aquimarina DSM 16071)
MIDMIVDGLIIGFKISLILLPLILAVAYTTFAERKLIGYMQLRLGPNRVGPKGWLQPIAD
VIKLLMKEIVIPSGANKALFLIAPVLFIAPSFAAWAVIPFNAELVLADINVGLLYILAMT
SIAVYGVIIAGWASNSKYALLGSLRSASQIVSYEIAMGFALVAVLMASGSMNLGEIVKAQ
EGPFWHWYWIPLLPILAVYWISGVAETNRAPFDLPEGESEIVAGFHVEYAGIGFALFFLA
EYANMILISVLTALFFFGGWLNPFMGIPYLEAATDWIPGTVWLLLKAAWFLFMMIWLRAT
FPRYRYDQVMRLGWKVFIPVTVVWLIILTFMIKAGVGPWFTGRGVL