Protein Info for B158DRAFT_0119 in Kangiella aquimarina DSM 16071

Annotation: NADH dehydrogenase subunit I (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 TIGR01971: NADH-quinone oxidoreductase, chain I" amino acids 19 to 141 (123 residues), 143.1 bits, see alignment E=1.6e-46 PF13237: Fer4_10" amino acids 60 to 114 (55 residues), 28.9 bits, see alignment E=5e-10 PF00037: Fer4" amino acids 60 to 79 (20 residues), 24.3 bits, see alignment (E = 1.2e-08) amino acids 96 to 118 (23 residues), 29.4 bits, see alignment 2.7e-10 PF12800: Fer4_4" amino acids 61 to 75 (15 residues), 16.9 bits, see alignment (E = 3.7e-06) amino acids 102 to 115 (14 residues), 13.4 bits, see alignment (E = 4.9e-05) PF12838: Fer4_7" amino acids 62 to 116 (55 residues), 44.8 bits, see alignment E=7.8e-15 PF13187: Fer4_9" amino acids 62 to 116 (55 residues), 33 bits, see alignment E=2.7e-11

Best Hits

Swiss-Prot: 74% identical to NUOI2_NITOC: NADH-quinone oxidoreductase subunit I 2 (nuoI2) from Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 92% identity to kko:Kkor_0297)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>B158DRAFT_0119 NADH dehydrogenase subunit I (EC 1.6.5.3) (Kangiella aquimarina DSM 16071)
MSRMRRWFRSYFLTELIRGLRITWAHLRKRKVTVQYPEEKTPQSPRFRGLHALRRYPNGE
ERCIACKLCEAVCPAAAITIEAGPREKDGTRRTTRYEIDMFKCIYCGFCEESCPVDSIVE
TRIFDYHFEKRGDNILTKEQLLAIGDRYEAMIAEDRAKDAKYR