Protein Info for B158DRAFT_0119 in Kangiella aquimarina DSM 16071

Annotation: NADH dehydrogenase subunit I (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 19 to 141 (123 residues), 143.1 bits, E=1.6e-46
• PF13237: Fer4_10
  • amino acids 60 to 114 (55 residues), 28.9 bits, E=5e-10
• PF00037: Fer4
  • amino acids 60 to 79 (20 residues), 24.3 bits, see alignment (E = 1.2e-08)
  • amino acids 96 to 118 (23 residues), 29.4 bits, 2.7e-10
• PF12800: Fer4_4
  • amino acids 61 to 75 (15 residues), 16.9 bits, see alignment (E = 3.7e-06)
  • amino acids 102 to 115 (14 residues), 13.4 bits, see alignment (E = 4.9e-05)
• PF12838: Fer4_7
  • amino acids 62 to 116 (55 residues), 44.8 bits, E=7.8e-15
• PF13187: Fer4_9
  • amino acids 62 to 116 (55 residues), 33 bits, E=2.7e-11

Best Hits

Swiss-Prot: 74% identical to NUOI2_NITOC: NADH-quinone oxidoreductase subunit I 2 (nuoI2) from Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 92% identity to kko:Kkor_0297)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (3/6 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (163 amino acids)

>B158DRAFT_0119 NADH dehydrogenase subunit I (EC 1.6.5.3) (Kangiella aquimarina DSM 16071)
MSRMRRWFRSYFLTELIRGLRITWAHLRKRKVTVQYPEEKTPQSPRFRGLHALRRYPNGE
ERCIACKLCEAVCPAAAITIEAGPREKDGTRRTTRYEIDMFKCIYCGFCEESCPVDSIVE
TRIFDYHFEKRGDNILTKEQLLAIGDRYEAMIAEDRAKDAKYR