Protein Info for B158DRAFT_0117 in Kangiella aquimarina DSM 16071

Annotation: NADH:ubiquinone oxidoreductase subunit 11 or 4L (chain K)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00420: Oxidored_q2
  • amino acids 5 to 100 (96 residues), 104.9 bits, E=7.7e-35

Best Hits

Swiss-Prot: 73% identical to NUOK_CHRVO: NADH-quinone oxidoreductase subunit K (nuoK) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 97% identity to kko:Kkor_0299)

MetaCyc: 50% identical to ferredoxin-quinone oxidoreductase subunit E (Parasynechococcus marenigrum WH 8102)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (3/6 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (100 amino acids)

>B158DRAFT_0117 NADH:ubiquinone oxidoreductase subunit 11 or 4L (chain K) (Kangiella aquimarina DSM 16071)
MSLTHYLMVSAILFSISVIGIVINRKNVITLLMCIELMLLAVNTNFIAFSRYLNDEVGQI
FVFFILTVAAAEAAIGLAILVVLFRSNKDIDVEELRELKG