Protein Info for B158DRAFT_0116 in Kangiella aquimarina DSM 16071

Annotation: NADH dehydrogenase subunit L (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 78 to 107 (30 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 337 to 363 (27 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details amino acids 446 to 469 (24 residues), see Phobius details amino acids 489 to 508 (20 residues), see Phobius details amino acids 550 to 570 (21 residues), see Phobius details amino acids 650 to 670 (21 residues), see Phobius details TIGR01974: proton-translocating NADH-quinone oxidoreductase, chain L" amino acids 7 to 669 (663 residues), 800.8 bits, see alignment E=6.1e-245 PF00662: Proton_antipo_N" amino acids 70 to 120 (51 residues), 80.5 bits, see alignment 6.8e-27 PF00361: Proton_antipo_M" amino acids 136 to 448 (313 residues), 269.4 bits, see alignment E=3.6e-84

Best Hits

KEGG orthology group: K00341, NADH dehydrogenase I subunit L [EC: 1.6.5.3] (inferred from 91% identity to kko:Kkor_0300)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (672 amino acids)

>B158DRAFT_0116 NADH dehydrogenase subunit L (EC 1.6.5.3) (Kangiella aquimarina DSM 16071)
MSMQTQLLIIVLAPLLGAILAGLLGKRLGKRLTHRLTILGVAVSFILSLRVFWGYLYGNA
EPVDMTVYHWASFSELSIQIGFMIDSLSALMMVVVTFVSLMVHIYSIGYMHDDDGYQRFF
SYISLFTFSMLMLVMANNFLQLFFGWEAVGLVSYLLIGFWYQKETAIFANMKAFLVNRVG
DFGFILGIGAIFLLFGTFDYAPIFKTMGQAEEIMQISERSAENALGLMSLDGSFVAWGDT
SWPIITFICICLFIGAMGKSAQVPLHVWLPDSMEGPTPISALIHAATMVTAGVFMVARMS
PLFEFSETALMVVTIIGAITALFMGLVAIVQNDIKRIIAYSTLSQLGYMVVALGVSAYSA
AIFHLFTHAFFKALLFLGAGSVIVALHHEQNIRKMGGLYKRLPLTYWTTLIGTLALIGTP
FFAGFYSKDAIIMATANAQGPAASFAYFAVMVGVVVTALYSIRMLLVVFHGKSALDDEHL
NQITESPRVITWPLIALAVPSLVIGWIMTQPMLDGNYFAESITVLTGHDTMQAFREEFTG
AMSFAMHGFMTPVFWLMMLGVIIAVIFIWLKPGWGMAAGKILSPVNQLLQKKYYFDEINQ
KIFAKGTYSLGDMLWQYGDKAVIDDGIVNSGAQTVGRIGKKLRKLQTGYLYHYALVMVLG
LIALLLWLMLRN