Protein Info for B158DRAFT_0100 in Kangiella aquimarina DSM 16071

Annotation: Na+/proline symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 304 to 333 (30 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details amino acids 435 to 452 (18 residues), see Phobius details PF00474: SSF" amino acids 32 to 403 (372 residues), 142.5 bits, see alignment E=8.8e-46

Best Hits

KEGG orthology group: None (inferred from 95% identity to kko:Kkor_0314)

Predicted SEED Role

"probable sodium:solute symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>B158DRAFT_0100 Na+/proline symporter (Kangiella aquimarina DSM 16071)
MNIVVLGVIFFVLVQFAVGLWASRKPKNETDFLLAGRRLNPGLAVFTIFATWFGAETCIG
AASSIYENGLSGGTADPFGFSLCLFLMGIVFAMPLWKRKFITFADLFRQRYSVRIEKLVV
IILVPASMLWAAAQIRAFGQILSSLSGLQVEYAITIAASVVIIYTMLGGLLAVAVTDVIQ
AGFLILGLVLLGIFVFASGDPNASLTSVDPARFSFVSEDSTLLQKFEAWAIPIFGSVLTQ
ELITRVLACRSAEEARSSTLKGASLYLVVGLIPVYLGLVGLNLMPNLADSEQLLPELAKS
YLPTIFYILFAGALVSAILSTVDSALLASSSLLSHNIVVPLSKRNHEVSERQKVLFARIG
IVVLGSLAYYIALHAKGVYDLVVTASAFGSAGVFVVGTFGLFTRFGGEITAGLTLVSAAT
IWILGEFVFGWATPFFISLLTGFGVYIIAALIERHFSGPAKGFQTA