Protein Info for B158DRAFT_0096 in Kangiella aquimarina DSM 16071

Annotation: Putative Mg2+ and Co2+ transporter CorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00571: CBS
  • amino acids 61 to 117 (57 residues), 28.3 bits, E=1.9e-10
  • amino acids 130 to 184 (55 residues), 25.4 bits, E=1.5e-09
• PF03471: CorC_HlyC
  • amino acids 205 to 277 (73 residues), 79.3 bits, E=1.7e-26

Best Hits

Swiss-Prot: 47% identical to CORC_SALTY: Magnesium and cobalt efflux protein CorC (corC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06189, magnesium and cobalt transporter (inferred from 92% identity to kko:Kkor_0318)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Protein Sequence (285 amino acids)

>B158DRAFT_0096 Putative Mg2+ and Co2+ transporter CorC (Kangiella aquimarina DSM 16071)
MSDDKPPSRSLLQRLTDIFTSEPQDRQQLVDLLRTAKDDKLIKPDSLSMMEGVLQVAEMQ
VRDIMIPRSQMAVIQEDMSLDEIIPIVKDSRHSRYPVVGENRDDIEGIMLAKELLSYAFA
DNGERAAFDIKDILRPAYIIPESKRLDVLLTEFRSKRNHMAIVVDEYGCVSGLVTIEDVL
EQIVGDIEDEFDVDEEETNIKLHTNGEYTVKAQTEISDFNDRLGAEFPDQEFDTIGGLLV
NKFGHMPERNETIEMGNFEFTVLNADQRRVHLLRVKPLVEAPVEA