Protein Info for B158DRAFT_0095 in Kangiella aquimarina DSM 16071

Annotation: apolipoprotein N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 33 to 48 (16 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 123 to 148 (26 residues), see Phobius details amino acids 162 to 187 (26 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 483 to 502 (20 residues), see Phobius details PF20154: LNT_N" amino acids 20 to 182 (163 residues), 124 bits, see alignment E=6.4e-40 TIGR00546: apolipoprotein N-acyltransferase" amino acids 63 to 454 (392 residues), 303.2 bits, see alignment E=1.6e-94 PF00795: CN_hydrolase" amino acids 228 to 463 (236 residues), 77.6 bits, see alignment E=9.8e-26

Best Hits

KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 88% identity to kko:Kkor_0319)

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (505 amino acids)

>B158DRAFT_0095 apolipoprotein N-acyltransferase (Kangiella aquimarina DSM 16071)
MITMLKSPTGWLGLTVALIAGALYPLGFAPLEWWPISIFSVAAIWWLLNGQTRKYSMALG
FSFGLGYFGVGVSWVYVSINTFGNAAPPLAVFLTIIFIAILSLFFVLLGWLNARFINRYS
LITQIIFFATIWLILDIARGSGFVSFPWLYLGYTQTSGPLLGVASLVGVHGVTLLLVVIS
CLVAVALTYDNKKTRTSSIMVLVILMMVGTSASLYQVKKETTQQKTLTIALIQPNIDQHK
KWDRNYFTPIVKGLFDQTEHYWGADLIVWPEAAIPAFDSQVPGILYELDELAKSSGSQFI
TGIPMLETRDEYYAGIKMLGSDQGDYQKQQLVPFGEYVPLGAWIRGMIDFFDLPMSSFTP
GSSQQTALKTEKADYIPAICYEIAFSGLMQQLATSTDQDQFKAIVTISNDTWFGKSWGPI
QHFQIAKMRAIETGLPVIRGTNNGITAIIDDKGRVINKIDRFQSNELAGAFLLENRNTWF
REYGYWSLLVLVMLLIIAAFALRKR