Protein Info for B158DRAFT_0084 in Kangiella aquimarina DSM 16071

Annotation: penicillin-binding protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details TIGR03423: penicillin-binding protein 2" amino acids 20 to 615 (596 residues), 729.9 bits, see alignment E=1.2e-223 PF03717: PBP_dimer" amino acids 65 to 238 (174 residues), 144.4 bits, see alignment E=5.5e-46 PF00905: Transpeptidase" amino acids 272 to 612 (341 residues), 248 bits, see alignment E=1.2e-77

Best Hits

KEGG orthology group: K05515, penicillin-binding protein 2 (inferred from 86% identity to kko:Kkor_0329)

Predicted SEED Role

"Penicillin-binding protein 2 (PBP-2)" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (642 amino acids)

>B158DRAFT_0084 penicillin-binding protein 2 (Kangiella aquimarina DSM 16071)
MYKRQAIKDVGRETSMFFARCIVALFIVFILMVVLISRQFKLQVLDYQKYQTQSENNRIS
IQSVAPVRGLIYDRDGKLLAQNRSIFTLEITPEQTRDLPKLVQELRNVLTISDEQVLKFL
EQIKFRPKFNSYVLKSNLTEEEVAKFSVVQHMYPGASLEARLERYYPYKGDLVHVLGRMG
AINVEELEAMDEETRLRYAATSKIGKLGLERYYESILHGEVGSQRVETDVRGRIIRVLER
DEPVAGMDIHLHLDLGLQRKATELMKEVGARGAIVAIEPATGGVLAMVSQPGYDPNLFTG
GISGEEYRKLLTPERPLYNRAVQGTYSPASTIKPHLAWLGLKEGVITPETKIRDPGWFSL
PNNDRRYRDWKRWGHAPYMDVVDSIIESCDTFFYDLAVRIGIDRIHEGMLQFGFGQKTGI
DMEEEKIGILPSREWKRTARKEPWYNGDTVNIGIGQGYWTVTPLQLANATAVIANDGIRY
QLQLVRKFVEGNIHEQNVPVMAYHQIEIGDGRWLDLVKESMRDVVTGAKGTARTAFQGAE
YIAAGKTGTAQVKSLGEEEEYDAETLAEKFHDNALFIGYAPYENPKIAIAVVMENAGGGG
SNAAPIARKLMDYYLIEQYLIEQHQESEQTTETEVVNNGSAQ