Protein Info for B158DRAFT_0083 in Kangiella aquimarina DSM 16071

Annotation: cell elongation-specific peptidoglycan biosynthesis regulator RodA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 57 to 74 (18 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 120 to 135 (16 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 311 to 335 (25 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details TIGR02210: rod shape-determining protein RodA" amino acids 24 to 370 (347 residues), 450.2 bits, see alignment E=2.7e-139 PF01098: FTSW_RODA_SPOVE" amino acids 28 to 370 (343 residues), 390.2 bits, see alignment E=4.3e-121

Best Hits

Swiss-Prot: 57% identical to RODA_SHIFL: Peptidoglycan glycosyltransferase MrdB (mrdB) from Shigella flexneri

KEGG orthology group: K05837, rod shape determining protein RodA (inferred from 93% identity to kko:Kkor_0330)

MetaCyc: 57% identical to peptidoglycan glycosyltransferase MrdB (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Rod shape-determining protein RodA" in subsystem Bacterial Cytoskeleton or Peptidoglycan Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129

Use Curated BLAST to search for 2.4.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>B158DRAFT_0083 cell elongation-specific peptidoglycan biosynthesis regulator RodA (Kangiella aquimarina DSM 16071)
MALLSSTANSHKERYSLLWRWHIDAPLLLGIIALMCFSLLAVYSAGGESIGLVKRQAVRF
AAGLVVMFVLAQFEPRTFRQWAPALYAVGVLFLIAVLLFGETSKGAQRWIDIGIRFQPSE
IMKLAVPLMVAWYFAEKALPPTFLQTVGSLVLVFTPVVLIMLQPDLGTSLLIGASGLFVV
FFAGIRWRYILGAILLAGVLIPIMWFFVMHDYQKGRVLTFLNPERDPLGAGYHIIQSQIA
IGSGGIYGKGWLNGTQSQLEFLPERHTDFIFAVIGEEFGLVGIVLLLALYAFVIVRGIYI
SLQGQETFSRLLGAALILTFFIYIFVNIGMVSGLLPVVGLPLPLISYGGTSIVTLMAAFG
ILMSIQTHRRLHST