Protein Info for B158DRAFT_0081 in Kangiella aquimarina DSM 16071

Annotation: lytic murein transglycosylase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13406: SLT_2
  • amino acids 38 to 326 (289 residues), 326.3 bits, E=8.7e-102
• TIGR02282: lytic murein transglycosylase B
  • amino acids 40 to 328 (289 residues), 379.4 bits, E=5.1e-118

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 87% identity to kko:Kkor_0331)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (344 amino acids)

>B158DRAFT_0081 lytic murein transglycosylase B (Kangiella aquimarina DSM 16071)
MRTNIKKTIGTLVLACSCAFSGMMAQANSELDKAPTDAKAFASYMHKKHGFTEDYVQMIL
DKVEVRQSILDAISRPAESKDWYEYRPIFIEQKRIKQGVQFWLEHEDILMRAEEKYQVPA
EIITAIIGVETRYGRVMGSFPVVDAIATLAFHYPKRGAFFAGELEEYFVLAREQGWDLAE
PKGSYAGAMGMGQFIPTSYRHYAVDFDGDGNINLFDNVEDAVGSVANYFHVHGWRMGEPV
AQFLPTPEAKLVAQFRNDSLKPQFTLGEMKSAGLEYQGPLEDNDIAGIYAFKQESKEEYW
LGFNNFYVITRYNRSPLYAMAVHQLSLEIKDAVEHAKQNLVEAK