Protein Info for B158DRAFT_0078 in Kangiella aquimarina DSM 16071

Annotation: Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01063: Aminotran_4
  • amino acids 30 to 255 (226 residues), 167.3 bits, E=2.5e-53

Best Hits

Swiss-Prot: 40% identical to DAAA_BACSU: D-alanine aminotransferase (dat) from Bacillus subtilis (strain 168)

KEGG orthology group: K00824, D-alanine transaminase [EC: 2.6.1.21] (inferred from 88% identity to kko:Kkor_0334)

Predicted SEED Role

"D-alanine aminotransferase (EC 2.6.1.21)" in subsystem Pyruvate Alanine Serine Interconversions (EC 2.6.1.21)

MetaCyc Pathways

• D-alanine degradation (1/1 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• D-Alanine metabolism
• D-Arginine and D-ornithine metabolism
• Lysine degradation
• Phenylalanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.21

Protein Sequence (299 amino acids)

>B158DRAFT_0078 Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase (Kangiella aquimarina DSM 16071)
MSIAYLNGQLLAIEEAKVPALDRGFLFGDGVYEVIPVYAGRLFRFKQHIARLENSLRGIR
LPMEQTLQDWANICHQLIEQNSLNNASIYLQITRGAYPERNHDFPANPNPTIFAMITALP
EVQAVPSDKDLQGISVITAEDIRWQRCDIKAITLLANCMLKQQALECGANDTILVRGGVA
FEATSSNLFIVRDGVIITPPLSEHLLPGITRDFLLWLAEQHGILTEQRLIPEHELLQADE
IWLTSSTKEIRPVTRLNDVTIGDGTAGPVWRQMYDHYQQLKVQLYRGEIDSNTEGEIAL