Protein Info for B158DRAFT_0075 in Kangiella aquimarina DSM 16071

Annotation: lipoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00510: lipoyl synthase
  • amino acids 52 to 338 (287 residues), 449.8 bits, E=2.3e-139
• PF16881: LIAS_N
  • amino acids 52 to 93 (42 residues), 40.6 bits, 2.9e-14
• PF04055: Radical_SAM
  • amino acids 108 to 272 (165 residues), 89.5 bits, E=3e-29

Best Hits

Swiss-Prot: 69% identical to LIPA_COXBN: Lipoyl synthase (lipA) from Coxiella burnetii (strain Dugway 5J108-111)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 95% identity to kko:Kkor_0337)

MetaCyc: 65% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
• lipoate biosynthesis and incorporation II (1/3 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Protein Sequence (341 amino acids)

>B158DRAFT_0075 lipoate synthase (Kangiella aquimarina DSM 16071)
MSNSEPVKNQTNQTVSSNVTGKIAAKAKKVVPGQKMRAEDKMARIPVKIMPTEEMPRKPD
WIRVRLPNGNQITKIKDMLRNNKLHTVCEEASCPNLPECFGHGTATFMIMGDICTRRCPF
CDVAHGRPLALDPEEPQNLADSVKSMGLKYVVITSVDRDDLRDGGSAHITECVRVAKEQN
PGLKVEVLVPDFRGRMEVALDLMADGLPDVFNHNLETVPRLYKQARPGADYQWSLDLLKQ
FKERYPGIPTKSGLMIGLGETNEEIIEVMKDLRAHGVEMLTLGQYLQPSKYHHPVMRFMP
PKEFDELGKIAEEMGFTNVASGPMVRSSYHADMQAAGEKVS