Protein Info for B158DRAFT_0054 in Kangiella aquimarina DSM 16071

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 870 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13185: GAF_2" amino acids 43 to 186 (144 residues), 41.4 bits, see alignment E=7.8e-14 PF01590: GAF" amino acids 44 to 175 (132 residues), 39.2 bits, see alignment E=4.5e-13 TIGR00229: PAS domain S-box protein" amino acids 199 to 318 (120 residues), 53.8 bits, see alignment E=2e-18 amino acids 317 to 444 (128 residues), 77.6 bits, see alignment E=9e-26 PF00989: PAS" amino acids 201 to 308 (108 residues), 34.4 bits, see alignment E=8.5e-12 amino acids 345 to 434 (90 residues), 55.6 bits, see alignment E=2.2e-18 PF08448: PAS_4" amino acids 206 to 313 (108 residues), 29.5 bits, see alignment E=3.3e-10 amino acids 342 to 437 (96 residues), 39.7 bits, see alignment E=2.3e-13 PF13426: PAS_9" amino acids 210 to 310 (101 residues), 26.5 bits, see alignment E=2.9e-09 amino acids 340 to 436 (97 residues), 80 bits, see alignment E=6.2e-26 PF08447: PAS_3" amino acids 346 to 429 (84 residues), 56.1 bits, see alignment E=1.6e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 444 to 605 (162 residues), 133.2 bits, see alignment E=7.2e-43 PF00990: GGDEF" amino acids 448 to 602 (155 residues), 139.5 bits, see alignment E=3.9e-44 PF00563: EAL" amino acids 624 to 856 (233 residues), 252.5 bits, see alignment E=1.7e-78

Best Hits

KEGG orthology group: None (inferred from 86% identity to kko:Kkor_0358)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (870 amino acids)

>B158DRAFT_0054 PAS domain S-box/diguanylate cyclase (GGDEF) domain (Kangiella aquimarina DSM 16071)
MMLAAGLVISIFLWRKASDESIATKNLLNAQYRTLNSVVKFKSLEDKLDDICSLIESQID
DALSSVMLADDAGETLKPIASPQLPQSFLQALDGLPISENIGACGSAAATGKAVIVDDML
KDSRFDEFHDLIHGYDLRACWSHPIFSSESKKPVGTFALYFRKPRSPKEGELDLILRSRD
LAALIIEQHQQRLKRERFEQHNRSLFTHNPEAVFTFDLEGRFTSVNKAACELMKCSQDDL
LGQHYSVAVIEQDLARTNEHFYAARRGIPQRYEICTPDMQGNIHYLHITNMPIIIDGEVT
GVHGIALDMTREKQHEERAKILERSVESSTHGLLISDARADDYPTIYANQAFEEITGYSQ
EDILGKNCRMLQGPDTDQKTRKAIKKALQNNEEISTVIKNYKKDGTPFWNELLISPVKDA
HGKVTHFIGLQNDITERIQRQEALEFNASHDPLTHLKNRSALERYLMEWVKSNDNSHNIY
ILFIDLDGFKPINDSLGHEFGDQVLVETAQRLNNEIVEPNMLARFGGDEFVAVIQDLTDH
EQVEVLARKLLTIVGESYKVDDIEVSLSAAIGIASSEESFKHPMELIQRADIAMYEAKKR
GGSYIYWHSAELNTNIDQQVAIRAQLQDAIQNNQFELFYQPIMSHDNKIGGVEALIRWKH
PIKGYISPAEFIPVAERTGQIIPISEWVLNQACKDVKDLKTLGVNSVSVNFSPIQFYRED
FIEKIAETLKTHSIQPGDITVEITENVLVHDTAHITVLLQELRHLGLDVAIDDFGSGFAS
LRYLNMLPVNKLKIDRSFTGNIHQNAHNAAITRGILGMTTEMKIEVVAEGVETDEEYQYL
REHKCDFMQGYLFCRPIPIKELIEWVQNRH