Protein Info for B158DRAFT_0049 in Kangiella aquimarina DSM 16071

Annotation: GTP cyclohydrolase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00925: GTP_cyclohydro2
  • amino acids 8 to 169 (162 residues), 224.7 bits, E=2.5e-71
• TIGR00505: GTP cyclohydrolase II
  • amino acids 8 to 192 (185 residues), 271.1 bits, E=2.2e-85

Best Hits

Swiss-Prot: 64% identical to RIBA_SHELP: GTP cyclohydrolase-2 (ribA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01497, GTP cyclohydrolase II [EC: 3.5.4.25] (inferred from 95% identity to kko:Kkor_0362)

MetaCyc: 63% identical to GTP cyclohydrolase 2 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase II. [EC: 3.5.4.25]

Predicted SEED Role

"GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• toxoflavin biosynthesis (3/7 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25

Use Curated BLAST to search for 3.5.4.25

Protein Sequence (193 amino acids)

>B158DRAFT_0049 GTP cyclohydrolase II (Kangiella aquimarina DSM 16071)
MTHKDSLSARLPTPWGDFTIHALEAEDGKEHVALTFGEWETKQPVLARIHSECLTGDALF
SLRCDCGFQLKAALQKIAEEGAGVLLYLRQEGRGIGLTNKIRAYSLQDQGMDTVQANEHL
GFGADERDFKVASDALDKLGIQKIRLMTNNPRKVSSMIDAGIDVVERVPLKYGHNPHNED
YLSTKQSKLGHLF