Protein Info for B158DRAFT_0032 in Kangiella aquimarina DSM 16071

Annotation: Predicted metal-dependent hydrolase of the TIM-barrel fold

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 62% identical to ACMSD_DICDI: 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (acmsd) from Dictyostelium discoideum

KEGG orthology group: K03392, aminocarboxymuconate-semialdehyde decarboxylase [EC: 4.1.1.45] (inferred from 97% identity to kko:Kkor_0379)

MetaCyc: 62% identical to aminocarboxymuconate-semialdehyde decarboxylase (Homo sapiens)
Aminocarboxymuconate-semialdehyde decarboxylase. [EC: 4.1.1.45]

Predicted SEED Role

"2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (EC 4.1.1.45)" (EC 4.1.1.45)

MetaCyc Pathways

L-tryptophan degradation III (eukaryotic) (10/15 steps found)
2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (2/4 steps found)
2-amino-3-carboxymuconate semialdehyde degradation to glutaryl-CoA (2/5 steps found)
L-tryptophan degradation IX (7/12 steps found)
2-nitrobenzoate degradation I (3/7 steps found)
L-tryptophan degradation XII (Geobacillus) (6/12 steps found)
L-tryptophan degradation XI (mammalian, via kynurenine) (11/23 steps found)

KEGG Metabolic Maps

Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>B158DRAFT_0032 Predicted metal-dependent hydrolase of the TIM-barrel fold (Kangiella aquimarina DSM 16071)
MSDLKIDIHTHILPKNWPDLKERYGYGGFVQLEHHKCDCARMMVDGKFFREVQENCWSPE
VRMKDCDHHGVHVQVLSTVPIMFNYWAKPEDTLDLSRFLNDHIAEVVERYPTRFVGLGTL
PMQSPKLAIQELERCVKELGLAGVQIGSHINDWNLSDENLFDVFAAAEELGAAVFVHPWD
MVGKEKMQKYWMPWLVGMPAESSLAICSMIFGGVLERLPNLRIAFAHGGGSFPATLGRIE
HAYDVRPDLMRVDNPHHPRKYLEQIYLDTLVHDPKMLEYLVDLMGPHKLALGTDYPFPLG
ELEPGKLIESMEYDKAISDRLLHGTALEWLNLEKGRFV