Protein Info for B158DRAFT_0031 in Kangiella aquimarina DSM 16071

Annotation: 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06052: 3-HAO
  • amino acids 9 to 156 (148 residues), 206.4 bits, E=1.7e-65
• TIGR03037: 3-hydroxyanthranilate 3,4-dioxygenase
  • amino acids 12 to 170 (159 residues), 238.4 bits, E=1.8e-75
• PF07883: Cupin_2
  • amino acids 48 to 101 (54 residues), 32.4 bits, E=6.2e-12

Best Hits

Swiss-Prot: 57% identical to 3HAO_XANC8: 3-hydroxyanthranilate 3,4-dioxygenase (nbaC) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K00452, 3-hydroxyanthranilate 3,4-dioxygenase [EC: 1.13.11.6] (inferred from 95% identity to kko:Kkor_0380)

MetaCyc: 44% identical to 3-hydroxyanthranilate 3,4-dioxygenase (Geobacillus thermodenitrificans NG80-2)
3-hydroxyanthranilate 3,4-dioxygenase. [EC: 1.13.11.6]

Predicted SEED Role

"3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6)" in subsystem NAD and NADP cofactor biosynthesis global or Quinolinic acid and its derivatives (EC 1.13.11.6)

MetaCyc Pathways

• NAD de novo biosynthesis II (from tryptophan) (9/9 steps found)
• L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (5/5 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• L-tryptophan degradation III (eukaryotic) (10/15 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• L-tryptophan degradation IX (7/12 steps found)
• 2-nitrobenzoate degradation I (3/7 steps found)
• L-tryptophan degradation XII (Geobacillus) (6/12 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (11/23 steps found)

KEGG Metabolic Maps

• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.6

Protein Sequence (180 amino acids)

>B158DRAFT_0031 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) (Kangiella aquimarina DSM 16071)
MSDKTLTPVPPFNFQKWIDENRHLLQPPVCNKQVFEQDDFIVMVVGGPNGRRDYHYDEGP
EFFYQLEGEMELRTIQNGERVNYPIKAGEIFLLPPKVPHSPVRFENSIGLVVERKRLGHE
KDGLMWFCENCDTKLYEEYFHLTNVEKDFLPVFERFLESEEHRTCSNCGTVMPKQNKLDL