Protein Info for B158DRAFT_0030 in Kangiella aquimarina DSM 16071

Annotation: Putative translation initiation inhibitor, yjgF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01042: Ribonuc_L-PSP
  • amino acids 9 to 136 (128 residues), 91.9 bits, E=1.5e-30

Best Hits

KEGG orthology group: K15067, 2-aminomuconate deaminase [EC: 3.5.99.5] (inferred from 94% identity to kko:Kkor_0381)

Predicted SEED Role

"Bona fide RidA/YjgF/TdcF/RutC subgroup"

MetaCyc Pathways

• L-tryptophan degradation III (eukaryotic) (10/15 steps found)
• 2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (2/4 steps found)
• 2-amino-3-carboxymuconate semialdehyde degradation to glutaryl-CoA (2/5 steps found)
• L-tryptophan degradation IX (7/12 steps found)
• 2-aminophenol degradation (1/4 steps found)
• 2-nitrobenzoate degradation I (3/7 steps found)
• L-tryptophan degradation XII (Geobacillus) (6/12 steps found)
• 4-nitrotoluene degradation II (1/9 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (11/23 steps found)

KEGG Metabolic Maps

• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.5

Protein Sequence (140 amino acids)

>B158DRAFT_0030 Putative translation initiation inhibitor, yjgF family (Kangiella aquimarina DSM 16071)
MSEKFVSSTAPEPVGLYPHARRVGHLLFLSGVGPRKKGSKDIPGVTLDDEGNIVDYCIET
QCRSVFENVRAILQDSGSSWDQLVDVQVFLTNMKDDFKTYNKVYAEYFADNQPCRTTIEI
SSLPTPIAIELKCIATIYDD