Protein Info for B158DRAFT_0024 in Kangiella aquimarina DSM 16071

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 9 to 199 (191 residues), 126.2 bits, E=1.7e-40
• PF08659: KR
  • amino acids 12 to 125 (114 residues), 26 bits, E=1.2e-09
• PF13561: adh_short_C2
  • amino acids 17 to 259 (243 residues), 150.9 bits, E=6.9e-48

Best Hits

Swiss-Prot: 35% identical to BACG_BACSU: NADPH-dependent reductase BacG (bacG) from Bacillus subtilis (strain 168)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 93% identity to kko:Kkor_0388)

MetaCyc: 35% identical to 3-[(5R)-5-hydroxy-7-oxabicyclo[4.1.0]heptan-2-ylidene]-2-oxopropanoate reductase (Bacillus subtilis)
1.3.1.aa [EC: 1.3.1.aa]; 1.3.1.aa [EC: 1.3.1.aa]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (40/53 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (16/20 steps found)
• biotin biosynthesis I (12/15 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (7/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (12/16 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• gondoate biosynthesis (anaerobic) (3/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
• oleate biosynthesis IV (anaerobic) (10/14 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (22/31 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• fatty acid elongation -- saturated (3/5 steps found)
• superpathway of fatty acid biosynthesis II (plant) (30/43 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• bacilysin biosynthesis (3/10 steps found)
• anteiso-branched-chain fatty acid biosynthesis (17/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (17/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (17/34 steps found)
• streptorubin B biosynthesis (15/34 steps found)
• mycolate biosynthesis (16/205 steps found)
• superpathway of mycolate biosynthesis (17/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.3.1.aa

Protein Sequence (263 amino acids)

>B158DRAFT_0024 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Kangiella aquimarina DSM 16071)
MMNLDLTGKNALVCGSSQGMGKAIAEQLASQGASVILLARNKAKLEAVLEGLDKSKGQKH
VVLVADFAYPEQVKATVFEFLKSGRLVEILVNNTGGPAPGPANSAETEDFLAAFNQHLIC
NHELMKLLTPGMKEAQYGRIINVISTSVKQPLHGLGVSNTVRGAVANWAKTLANELGQFN
ITVNNVLPGATNTVRLEAIIQNKAKKQGVSIEEMEEEEKSIIPMRRFGEPEEFANAVAFL
ASPAAAYITGINLPVDGGRTSCL